Svbp (NM_024462) Mouse Tagged ORF Clone

CAT#: MR200054

  • TrueORF®

Ccdc23 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK

Datasheet
SDS
Plasmid Map

Interest in protein/lysate? Submit request here!

Product Images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Svbp
Synonyms 2410005K17Rik; AI851162; Ccdc23
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200054 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCACCTGCCCGGAAAGAAAAATCCAAAGTTAAAGAACCAGCCTTCAGAGTGGAGAAGGCTAAGC
AGAAATCTGCCCAGCAGGAGCTGAAGCAAAGACAGAGAGCAGAGATCTATGCTCTCAACAGAGTCATGAC
GGAGCTGGAGCAGCAGCAGTTTGATGAGTTCTGTAAGCAGATGCAGCCGCCTGGGGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
>MR200054 protein sequence
Red=Cloning site Green=Tags(s)

MDPPARKEKSKVKEPAFRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024462
ORF Size 201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024462.2, NP_077782.1
RefSeq Size 748 bp
RefSeq ORF 201 bp
Locus ID 69216
UniProt ID Q99LQ4
Cytogenetics 4 D2.1
MW 7.8 kDa
Gene Summary Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146868). Also required to enhance the solubility and secretion of VASH1 and VASH2 (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

SKU Description Size
MC200194 Ccdc23 (untagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2, (10ug)
    • 10 ug

150,00 EUR

MR200054L3 Lenti ORF clone of Ccdc23 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2
    • 10 ug

450,00 EUR

MR200054L4 Lenti ORF clone of Ccdc23 (mGFP-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2
    • 10 ug

450,00 EUR