Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.

synthetic construction IA-2 Recombinant Protein

Imprimer

Conditionnement : 100ug

Demander plus d'informations

Product name	synthetic construction IA-2 Recombinant Protein
Uniprot ID	Q7KZS4
Uniprot link	http://www.uniprot.org/uniprot/Q7KZS4
Origin species	synthetic construction
Expression system	Prokaryotic expression
Raw Antigen Sequence	MAHNHRHKHKLLEVLFQGPHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
Molecular weight	44.72kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	Tris 50mMHCl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH 7
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	AAP36361.1
Spec:SwissProtID	Q7KZS4
NCBI Reference	AAP36361.1
Aliases /Synonyms	IA-2, Protein-tyrosine-phosphatase
Reference	PX-P2076
Note	For research use only
Molecular Constructor	Partial Yes

Specifications synthetic construction IA-2 Recombinant Protein