Conditionnement : 100ug
| Product name | PX-P5187-100 |
|---|---|
| Uniprot ID | P01137 |
| Uniprot link | https://www.uniprot.org/uniprot/P01137 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Molecular weight | 10.59 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Yeast |
| Fragment Type | Gly316-Ser390 |
| Protein Accession | P01137 |
| Aliases /Synonyms | TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB |
| Reference | PX-P5187 |
| Note | For research use only. |
| Molecular Constructor | His Gly316–Ser390 |