ZP3 Antibody
Référence orb527042-10ug
Conditionnement : 10ug
Marque : Biorbyt
ZP3 Antibody
Catalog Number: orb527042
Catalog Number | orb527042 |
---|---|
Category | Antibodies |
Description | ZP3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 47 kDa |
UniProt ID | P21754 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Zona pellucida sperm-binding protein 3; Sperm rece |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB analysis of ZP3 using anti-ZP3 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human A549 cell;4:human T-47D cell;5:human PC-3 cell;6:human U2OS cell.