Adrenocorticotropic hormone (TFA)
Katalog-Nummer HY-106373A-25mg
Size : 25mg
Marke : MedChemExpress
| Beschreibung |
Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone TFA stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone TFA regulates cortisol and androgen production. Adrenocorticotropic hormone TFA can promote the development of spermatogenesis. Adrenocorticotropic hormone TFA can relieve acute inflammation in gout models by inhibiting the polarization of macrophages to M1 type, inhibiting ROS and proinflammatory factor production and protecting mitochondrial function. Adrenocorticotropic hormone TFA can be used for the researches of inflammation, endocrinology, metabolic disease, such as gout and nephrotic syndrome[1][2][3][4]. |
||||||||
|---|---|---|---|---|---|---|---|---|---|
| IC50 & Target[3] |
|
||||||||
| In Vitro |
Adrenocorticotropic hormone (100 nM, 5weeks) TFA induces clusters development of spermatogenesis isolated from mouse seminiferous tubules and significantly increases the proportion of pre-meiotic cells (CDH-1, VASA, MC2R-positive) and the expression of PLZF, VASA, MC2R, THY-1 genes[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. |
||||||||
| In Vivo |
Adrenocorticotropic hormone (0.25-2.5 U/mL, s.c., 30 minutes after MSU intra-articular injection) TFA significantly alleviates joint swelling, reduces inflammatory cell infiltration in joint tissues, and has no significant effect on serum cortisol levels in gout mice models[3]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
|
||||||||
| Klinische Studie |
|
||||||||
| Molekulargewicht |
4541.14 (free base) |
||||||||
| Formel |
C207H308N56O58S.xC2HF3O2 |
||||||||
| Appearance |
Solid |
||||||||
| Color |
White to off-white |
||||||||
| Sequence |
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
||||||||
| Sequence Shortening |
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
||||||||
| Versand | Room temperature in continental US; may vary elsewhere. |
||||||||
| Speicherung |
Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
||||||||
| Lösungsmittel & Löslichkeit |
In Vitro:
H2O : 50 mg/mL (Need ultrasonic)
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
|
||||||||
| Reinheit & Dokumentation | |||||||||
| Verweise |
|

