Anxa13 antibody - middle region
Katalog-Nummer ARP42858_P050
Size : 100ul
Marke : Aviva Systems Biology
Anxa13 Antibody - middle region (ARP42858_P050)
| Datasheets/Manuals | Printable datasheet for anti-Anxa13 (ARP42858_P050) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 90%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Anxa13 (ARP42858_P050) antibody is Catalog # AAP42858 (Previous Catalog # AAPS10712) |
| Gene Symbol | Anxa13 |
|---|---|
| Gene Full Name | Annexin A13 |
| Alias Symbols | AV055219, 1810034H17Rik |
| NCBI Gene Id | 69787 |
| Protein Name | Annexin A13 |
| Description of Target | The function of Anxa13 remains unknown. |
| Uniprot ID | Q99JG3 |
| Protein Accession # | NP_081487 |
| Nucleotide Accession # | NM_027211 |
| Protein Size (# AA) | 317 |
| Molecular Weight | 36kDa |




