Anxa13 antibody - middle region

Katalog-Nummer ARP42858_P050

Size : 100ul

Marke : Aviva Systems Biology


Anxa13 Antibody - middle region (ARP42858_P050)

Datasheets/ManualsPrintable datasheet for anti-Anxa13 (ARP42858_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 90%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Anxa13 (ARP42858_P050) antibody is Catalog # AAP42858 (Previous Catalog # AAPS10712)
Gene SymbolAnxa13
Gene Full NameAnnexin A13
Alias SymbolsAV055219, 1810034H17Rik
NCBI Gene Id69787
Protein NameAnnexin A13
Description of TargetThe function of Anxa13 remains unknown.
Uniprot IDQ99JG3
Protein Accession #NP_081487
Nucleotide Accession #NM_027211
Protein Size (# AA)317
Molecular Weight36kDa