APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His)
Katalog-Nummer NB-64-48774-500ug
Size : 500ug
Marke : Neo Biotech
Remove All
APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His)
(Synonyms: L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b (APX1b;AtAPx02), cytosolic, APX2, APX1B) Copy Product InfoSynonyms: L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b (APX1b;AtAPx02), cytosolic, APX2, APX1B
Catalog No. TMPH-00096 Copy Product Info
APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6. |
| Species | Arabidopsis thaliana |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q1PER6 |
| Amino Acid | KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK |
| Construction | 4-250 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b (APX1b;AtAPx02), cytosolic, APX2, APX1B |
| Molecular Weight | 31.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
APX1bAPX 2APX 1b
Related Tags: APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) chemical structure | APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

