CD81 Antibody - C-terminal region

Katalog-Nummer ARP63231_P050-25UL

Size : 25ul

Marke : Aviva Systems Biology


CD81 Antibody - C-terminal region (ARP63231_P050)

Datasheets/ManualsPrintable datasheet for anti-CD81 (ARP63231_P050) antibody
Product Info
Publications

Blake Ebert, Alex J Rai. Isolation and Characterization of Amniotic Fluid-Derived Extracellular Vesicles for Biomarker Discovery. Methods Mol Biol. 1885, 287-294 (2018). 30506205

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Goat, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human CD81
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD81 (ARP63231_P050) antibody is Catalog # AAP63231
Enhanced Validation
Relative Expression (Western Blot)
Avivasheild
Gene SymbolCD81
Gene Full NameCD81 molecule
Alias SymbolsS5.7, CVID6, TAPA1, TSPAN28
NCBI Gene Id975
Protein NameCD81 antigen
Description of TargetThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP60033
Protein Accession #NP_001284578.1
Nucleotide Accession #NM_001297649.1
Protein Size (# AA)274
Molecular Weight30 kDa

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
4030-05
 1.0mL 
AAP61171
 100ug