CD81 Antibody - C-terminal region
Katalog-Nummer ARP63231_P050-25UL
Size : 25ul
Marke : Aviva Systems Biology
CD81 Antibody - C-terminal region (ARP63231_P050)
| Datasheets/Manuals | Printable datasheet for anti-CD81 (ARP63231_P050) antibody |
|---|
| Publications | Blake Ebert, Alex J Rai. Isolation and Characterization of Amniotic Fluid-Derived Extracellular Vesicles for Biomarker Discovery. Methods Mol Biol. 1885, 287-294 (2018). 305062051$s> |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Cow, Dog, Goat, Horse, Pig, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CD81 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CD81 (ARP63231_P050) antibody is Catalog # AAP63231 |
| Enhanced Validation |
| Gene Symbol | CD81 |
|---|---|
| Gene Full Name | CD81 molecule |
| Alias Symbols | S5.7, CVID6, TAPA1, TSPAN28 |
| NCBI Gene Id | 975 |
| Protein Name | CD81 antigen |
| Description of Target | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | P60033 |
| Protein Accession # | NP_001284578.1 |
| Nucleotide Accession # | NM_001297649.1 |
| Protein Size (# AA) | 274 |
| Molecular Weight | 30 kDa |







