CD91 Recombinant Protein

Katalog-Nummer NB-21-24438

Size : 100ug

Marke : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07954
Molecular weight:
37kDa
His Ala20~Gly292

Specifications CD91 Recombinant Protein

Product name PX-P4094-100
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 37kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20~Gly292
Aliases /Synonyms A2MR,APR
Reference PX-P4094
Note For research use only
Molecular Constructor
His Ala20~Gly292
Product name PX-P4094-1MG
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 37kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20~Gly292
Aliases /Synonyms A2MR,APR
Reference PX-P4094
Note For research use only
Molecular Constructor
His Ala20~Gly292
Product name PX-P4094-50
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 37kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20~Gly292
Aliases /Synonyms A2MR,APR
Reference PX-P4094
Note For research use only
Molecular Constructor
His Ala20~Gly292

Description

General Information about CD91 Recombinant Protein

The 1 receptor of the related 1-lipoprotein protein (LRP1), also known as alpha-2-macroglobulin receptor (A2MR), apolipoprotein E receptor (APOER) or differentiation cluster 91 (CD91), is a Protein forming a receptor, which is present in cells and participate in receptor-mediated endocytosis. In humans, the LRP1 protein is encoded by the LRP1 gene. LRP1 is also a key signaling protein and is therefore involved in several biological processes, such as lipoprotein metabolism and cell movement, as well as neurodegenerative diseases, atherosclerosis and cancer.

Documents

QC & Validation

SDS-PAGE for CD91 Recombinant Protein

SDS-PAGE for CD91 Recombinant Protein

CD91 Recombinant Protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

3D Representation

CD91 Recombinant Protein

Reviews

There are no reviews yet.

Be the first to review “CD91 Recombinant Protein” Cancel reply

Related products

  • Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

    PX-TA1078

    Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade