Envelope glycoprotein G(US4)

Katalog-Nummer NB-21-24563

Size : 50ug

Marke : Neo Biotech


Envelope glycoprotein G(US4)

Product name Envelope glycoprotein G(US4)
Uniprot ID A7U885
Uniprot link https://www.uniprot.org/uniprot/A7U885
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight 42.8kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >50% by SDS-PAGE
Buffer TBS, pH 8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Ppr490-Asp649
Aliases /Synonyms Glycoprotein G,US4,gG
Reference PX-P4760
Note For research use only
Molecular Constructor
GST Ppr490–Asp649