PX-TA1437
Size : 100ug
| Product name | Fibroblast Growth Factor proteins 23(FGF23) |
|---|---|
| Uniprot ID | Q9GZV9 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9GZV9 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
| Molecular weight | 8.73kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.4 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser180-Ile251 |
| Protein Accession | Q9GZV9 |
| Spec:Entrez GeneID | 8074 |
| Spec:NCBI Gene Aliases | ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC |
| Spec:SwissProtID | Q4V758 |
| NCBI Reference | Q9GZV9 |
| Aliases /Synonyms | Phosphatonin,Tumor-derived hypophosphatemia-inducing factor,HYPF |
| Reference | PX-P4768 |
| Note | For research use only |
| Molecular Constructor | His Ser180–Ile251 |
| Product name | Fibroblast Growth Factor proteins 23(FGF23) |
|---|---|
| Uniprot ID | Q9GZV9 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9GZV9 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
| Molecular weight | 8.73kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.4 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser180-Ile251 |
| Protein Accession | Q9GZV9 |
| Spec:Entrez GeneID | 8074 |
| Spec:NCBI Gene Aliases | ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC |
| Spec:SwissProtID | Q4V758 |
| NCBI Reference | Q9GZV9 |
| Aliases /Synonyms | Phosphatonin,Tumor-derived hypophosphatemia-inducing factor,HYPF |
| Reference | PX-P4768 |
| Note | For research use only |
| Molecular Constructor | His Ser180–Ile251 |
| Product name | PX-P4768-1MG |
|---|---|
| Uniprot ID | Q9GZV9 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9GZV9 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
| Molecular weight | 8.73kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.4 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser180-Ile251 |
| Protein Accession | Q9GZV9 |
| Spec:Entrez GeneID | 8074 |
| Spec:NCBI Gene Aliases | ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC |
| Spec:SwissProtID | Q4V758 |
| NCBI Reference | Q9GZV9 |
| Aliases /Synonyms | Phosphatonin,Tumor-derived hypophosphatemia-inducing factor,HYPF |
| Reference | PX-P4768 |
| Note | For research use only |
| Molecular Constructor | His Ser180–Ile251 |
There are no reviews yet.