FUNDC1 Antibody - N-terminal region
Katalog-Nummer ARP53280_P050-25UL
Size : 25ul
Marke : Aviva Systems Biology
FUNDC1 Antibody - N-terminal region (ARP53280_P050)
| Datasheets/Manuals | Printable datasheet for anti-FUNDC1 (ARP53280_P050) antibody |
|---|
| Publications | Michael Li-Hsuan Huang, Sutharshani Sivagurunathan, Samantha Ting, Patric J Jansson, Christopher J D Austin, Matthew Kelly, Christopher Semsarian, Daohai Zhang, Des R Richardson. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2α phosphorylation, and the induction of downstream targets. Am J Pathol. 183, 745-57 (2013). WB 238868901 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX. J Biol Chem. 289, 10691-10701 (2014). WB 245736721$s> Weili Tian, Wen Li, Yinqin Chen, Zeming Yan, Xia Huang, Haixia Zhuang, Wangtao Zhong, Yusen Chen, Wenxian Wu, Chunxia Lin, Hao Chen, Xiaoyan Hou, Liangqing Zhang, Senfang Sui, Bin Zhao, Zhe Hu, Longxuan Li, Du Feng. Phosphorylation of ULK1 by AMPK regulates translocation of ULK1 to mitochondria and mitophagy. FEBS Lett. 589, 1847-54 (2015). WB 259806071$s> |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IP |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762) |
| Enhanced Validation |
| Reference | Ross,M.T., (2005) Nature 434 (7031), 325-337 |
|---|---|
| Gene Symbol | FUNDC1 |
| Gene Full Name | FUN14 domain containing 1 |
| Alias Symbols | MGC51029 |
| NCBI Gene Id | 139341 |
| Protein Name | FUN14 domain-containing protein 1 |
| Description of Target | FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown. |
| Uniprot ID | Q8IVP5 |
| Protein Accession # | NP_776155 |
| Nucleotide Accession # | NM_173794 |
| Protein Size (# AA) | 155 |
| Molecular Weight | 17 kDa |
| Protein Interactions | SLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC; |






