Interleukin-6 fragment (human) [145990-81-4]
Katalog-Nummer HY-P4720
Size : Onrequest
Marke : MedChemExpress
| Beschreibung |
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis[1]. |
|---|---|
| Molekulargewicht |
4023.48 |
| Formel |
C179H281N45O58S |
| CAS. Nr. | |
| Sequence |
Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys |
| Sequence Shortening |
IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK |
| Versand | Room temperature in continental US; may vary elsewhere. |
| Speicherung |
Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reinheit & Dokumentation | |
| Verweise |

