MCM2 antibody - middle region
Katalog-Nummer ARP36646_P050
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-MCM2 (ARP36646_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MCM2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MCM2 (ARP36646_P050) antibody is Catalog # AAP36646 (Previous Catalog # AAPP07903) |
Reference | Boyd,A.S., (2008) J. Am. Acad. Dermatol. 58 (5), 750-754 |
Gene Symbol | MCM2 |
---|---|
Gene Full Name | Minichromosome maintenance complex component 2 |
Alias Symbols | BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN |
NCBI Gene Id | 4171 |
Protein Name | DNA replication licensing factor MCM2 |
Description of Target | This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P49736 |
Protein Accession # | NP_004517 |
Nucleotide Accession # | NM_004526 |
Protein Size (# AA) | 904 |
Molecular Weight | 102kDa |
Protein Interactions | HUWE1; MCM6; CHFR; SUMO2; MCMBP; UBC; SUMO1; MDM2; MCM7; MCM4; HSP90AB1; ACLY; PRRC1; HYOU1; CAP1; NCL; POLA1; TONSL; SNF8; ELL; TCEA1; POLR2A; CDK6; CDK4; CDC6; MCM10; ORC6; CCNB2; VCAM1; P2RX4; ORC5; ORC2; MCM5; MCM3; ITGA4; FN1; CSNK2A1; CDKN2A; DBF4; |
-
What is the species homology for "MCM2 Antibody - middle region (ARP36646_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "MCM2 Antibody - middle region (ARP36646_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MCM2 Antibody - middle region (ARP36646_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MCM2 Antibody - middle region (ARP36646_P050)"?
This target may also be called "BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN" in publications.
-
What is the shipping cost for "MCM2 Antibody - middle region (ARP36646_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "MCM2 Antibody - middle region (ARP36646_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MCM2 Antibody - middle region (ARP36646_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "102kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MCM2 Antibody - middle region (ARP36646_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MCM2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MCM2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MCM2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MCM2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MCM2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MCM2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.