MMP3 antibody - middle region
Katalog-Nummer ARP42041_P050
Size : 100ul
Marke : Aviva Systems Biology
MMP3 Antibody - middle region (ARP42041_P050)
| Datasheets/Manuals | Printable datasheet for anti-MMP3 (ARP42041_P050) antibody |
|---|
| Tested Species Reactivity | Human, Horse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MMP3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MMP3 (ARP42041_P050) antibody is Catalog # AAP42041 (Previous Catalog # AAPP24522) |
| Gene Symbol | MMP3 |
|---|---|
| Gene Full Name | Matrix metallopeptidase 3 (stromelysin 1, progelatinase) |
| Alias Symbols | SL-1, STMY, STR1, CHDS6, MMP-3, STMY1 |
| NCBI Gene Id | 4314 |
| Protein Name | Stromelysin-1 |
| Description of Target | MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase. |
| Uniprot ID | P28862 |
| Protein Accession # | NP_002413 |
| Nucleotide Accession # | NM_002422 |
| Protein Size (# AA) | 477 |
| Molecular Weight | 43kDa |
| Protein Interactions | MEOX2; SPOCK3; SPOCK1; TNFSF11; CCL8; CCL13; BCAN; TIMP1; TIMP3; MMP3; SERPINE1; PLG; SPP1; CCL7; CCL2; ACAN; IGFBP3; DCN; HAPLN1; |







