mouse Anti-PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) Monoclonal Antibody [Clone:3G10]

Katalog-Nummer 131518-100ug

Size : 100ug

Marke : US Biological



131518 PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3)

Clone Type
Monoclonal
Host
mouse
Source
human
Isotype
IgG2b,k
Grade
Affinity Purified
Applications
E
Crossreactivity
Hu
Accession #
BC019040, AAH19040
Shipping Temp
Blue Ice
Storage Temp
-20°C

Peripheral myelin protein 22 (PMP22) is a small, hydrophobic a tetraspan glycoprotein, with proposed roles in peripheral nerve myelin formation, cell-cell interactions, and cell proliferation. It is most prominently expressed by Schwann cells as a component of compact myelin of the peripheral nervous system (PNS), thus representing 2 to 5% of all myelin proteins. It is also observed in nonneural cells and tissues during development, such as in the epithelial cells of the lung and intestine. The human PMP-22 gene has been mapped to chromosome 17p11.2 and codes for a 22kD transmembrane glycoprotein. It plays a crucial role in normal physiological and pathological processes in the peripheral nervous system which includes correct myelination during development of peripheral nerves, the stability of myelin, and the maintenance of axons. Recent study revealed that genetic alterations in the PMP22 gene including duplications, deletions, and point mutations are responsible for the most common forms of hereditary peripheral neuropathies including Charcot-Marie-Tooth disease type 1A (CMT1A), hereditary neuropathy with liability to pressure palsies (HNPP), and a subtype of Dejerine-Sottas Syndrome (DSS).

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Applications
Product Type: Mab|Isotype: IgG2b,k|Clone No: 3G10|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.4|Purity: Purified by Protein A affinity chromatography|Immunogen: Partial recombinant corresponding to aa25-114 from human PMP22 with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human PMP22||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa25-114 from human PMP22 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography
Specificity
Recognizes human PMP22