OPCA03101-20UG | mt2 Recombinant Protein Clinisciences

MT2 Recombinant Protein (Zebrafish) (OPCA03101)

Datasheets/Manuals	Printable datasheet for MT2 Recombinant Protein (Zebrafish) (OPCA03101)

Product Info
Predicted Species Reactivity	Danio rerio\|Zebrafish
Product Format	Liquid or Lyophilized powder
Reconstitution and Storage	-20°C or -80°C
Peptide Sequence	MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
Source	Yeast

Gene Symbol	mt2
Gene Full Name	metallothionein 2
Alias Symbols	metallothionein A, metallothionein IIA, metallothionein IIB, metallothionein-1, metallothionein-2, mt, MT-2, mt1, wu:fc77e11, wu:fj10c11.
NCBI Gene Id	100174951
Protein Name	Metallothionein-2
Description of Target	Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Uniprot ID	Q7ZSY6
Protein Size (# AA)	Full Length
Molecular Weight	8 kDa