Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His)
Katalog-Nummer NB-64-52118-20ug
Size : 20ug
Marke : Neo Biotech
Remove All
Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His)
(Synonyms: PNC1, Nicotinamide deamidase (NAMase), Nicotinamidase) Copy Product InfoSynonyms: PNC1, Nicotinamide deamidase (NAMase), Nicotinamidase
Catalog No. TMPH-03449 Copy Product Info
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.0 kDa and the accession number is P53184.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.0 kDa and the accession number is P53184. |
| Species | Saccharomyces cerevisiae |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P53184 |
| Amino Acid | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK |
| Construction | 1-216 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | PNC1, Nicotinamide deamidase (NAMase), Nicotinamidase |
| Research Background | Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. |
| Molecular Weight | 29.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
PNC 1NAMase
Preview
Related Tags: Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His) chemical structure | Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote