Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag

Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag

Drucken Drucken
Melden Sie sich an

Katalog-Nummer 374661-20ug

Size : 20ug

Marke : US Biological


374661 Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag

Swiss Prot
Q96385
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Has pectate lyase activity.

Source:
Recombinant protein corresponding to aa22-375 from chamaecyparis obtusa, fused to His-Tag at N-terminal, expressed in Yeast.

Molecular Weight:
~40.1kD

Amino Acid Sequence:
DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Yeast|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)
References
1. Purification, characterization and molecular cloning of Cha o 1, a major allergen of Chamaecyparis obtusa (Japanese cypress) pollen. Suzuki M., Komiyama N., Itoh M., Itoh H., Sone T., Kuno K., Takagi I., Ohta N.Mol. Immunol. 33:451-460(1996).