Recombinant horse Serum amyloid A protein
Katalog-Nummer OPCA00214-1MG
Size : 1mg
Size : 1mg
| Datasheets/Manuals | Printable datasheet for SAA1 Recombinant Protein (Horse) (OPCA00214) |
|---|
| Predicted Species Reactivity | Equus caballus|Horse |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
| Protein Sequence | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-110 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84(1987) |
|---|---|
| Gene Symbol | SAA1 |
| Alias Symbols | Amyloid fibril protein AA |
| Protein Name | Serum amyloid A protein |
| Description of Target | Major acute phase reactant. Apolipoprotein of the HDL complex. |
| Uniprot ID | P19857 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 16.3 kDa |