ARO-A12767
Recombinant Human SYNGAP1 Protein, N-His
Katalog-Nummer NB-21-33581
Size : 100µg
Size : 100µg
| Product name | ARO-P10382-100 |
|---|---|
| Uniprot ID | Q96PV0 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH |
| Molecular weight | 15.79 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser1186-His1277 |
| Aliases /Synonyms | Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP |
| Reference | ARO-P10382 |
| Note | For research use only. |
| Molecular Constructor | Ser1186–His1277 |
| Product name | ARO-P10382-1MG |
|---|---|
| Uniprot ID | Q96PV0 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH |
| Molecular weight | 15.79 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser1186-His1277 |
| Aliases /Synonyms | Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP |
| Reference | ARO-P10382 |
| Note | For research use only. |
| Molecular Constructor | Ser1186–His1277 |
| Product name | ARO-P10382-50 |
|---|---|
| Uniprot ID | Q96PV0 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH |
| Molecular weight | 15.79 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser1186-His1277 |
| Aliases /Synonyms | Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP |
| Reference | ARO-P10382 |
| Note | For research use only. |
| Molecular Constructor | Ser1186–His1277 |
There are no reviews yet.