RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)
Katalog-Nummer TMPH-04816-1mg
Size : 1mg
Marke : TargetMol
RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)
(Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N)) Copy Product InfoRVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700.
For research use only—not for human use. No sales to individuals. Use as intended only.
User Guide of Recombinant Proteins
Product Introduction
Bioactivity
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700. |
| Species | RVFV |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P21700 |
| Amino Acid | MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA |
| Construction | 1-245 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris/PBS-based buffer |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Nucleoprotein, Nucleocapsid protein (Protein N) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |


