Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (PE)

SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (PE)

Drucken Drucken
Melden Sie sich an

Katalog-Nummer 133506-PE-100ul

Size : 100ul

Marke : US Biological


133506-PESLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (PE)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG1,k
GradeAffinity Purified
ApplicationsFLISA WB
CrossreactivityHu
Accession #NM_014037
Shipping TempBlue Ice
Storage Temp4°C Do Not Freeze

SLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP*

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 2E5|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa406-493 from human SLC6A16 (NP_054756) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SLC6A16.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa406-493 from human SLC6A16 (NP_054756) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC6A16.