SYNGAP1 Protein, Human, Recombinant (His)
Katalog-Nummer TMPH-01997-5ug
Size : 5ug
Marke : TargetMol
SYNGAP1 Protein, Human, Recombinant (His)
(Synonyms: SYNGAP1, Synaptic Ras GTPase-activating protein 1 (Synaptic Ras-GAP 1), Ras/Rap GTPase-activating protein SynGAP, Neuronal RasGAP, KIAA1938) Copy Product InfoSYNGAP1 Protein, Human, Recombinant (His) is expressed in E. coli.
User Guide of Recombinant Proteins
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | SYNGAP1 Protein, Human, Recombinant (His) is expressed in E. coli. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q96PV0 |
| Amino Acid | MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH |
| Construction | 1161-1343 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | SYNGAP1, Synaptic Ras GTPase-activating protein 1 (Synaptic Ras-GAP 1), Ras/Rap GTPase-activating protein SynGAP, Neuronal RasGAP, KIAA1938 |
| Research Background | Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits. |
| Molecular Weight | 25.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |


