Teriparatide acetate [99294-94-7]
Katalog-Nummer T21460-1mg
Size : 1mg
Marke : TargetMol
Teriparatide acetate
(Synonyms: Parathar acetate, hPTH 1-34 (acetate salt), Forteo) Copy Product InfoTeriparatide acetate (Forteo) is a PHT agonist, with an IC50 of 2 nM in HEK293 cells.Teriparatide acetate is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used to treat some forms of osteoporosis. Intermittent use of Teriparatide acetate activates osteoblasts more than osteoclasts, which leads to an overall increase in bone.
Select Batch
Purity:99.90%
Color:White
COA HPLC-MS MS
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Teriparatide acetate (Forteo) is a PHT agonist, with an IC50 of 2 nM in HEK293 cells.Teriparatide acetate is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used to treat some forms of osteoporosis. Intermittent use of Teriparatide acetate activates osteoblasts more than osteoclasts, which leads to an overall increase in bone. |
| Synonyms | Parathar acetate, hPTH 1-34 (acetate salt), Forteo |
| Molecular Weight | 4177.83 |
| Formula | C183H295N55O53S2 |
| Cas No. | 99294-94-7 |
| Smiles | CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CNC=N2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC5=CNC=N5)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC6=CC=CC=C6)C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N.CC(=O)O |
| Relative Density. | no data available |
| Sequence | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
| Sequence Short | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 20 mg/mL (4.79 mM), Sonication is recommended. DMSO: 25 mg/mL (5.98 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O/DMSO
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||



