Anti-Human OVOL1 Polyclonal Antibody

Katalog-Nummer NB-21-37478

Size : 100µg

Marke : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Specifications Anti-Human OVOL1 Polyclonal Antibody

Product name ARO-A11975-100
Uniprot ID O14753
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-A11975
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human OVOL1 (Asp116-Leu267).
Product name ARO-A11975-1MG
Uniprot ID O14753
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-A11975
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human OVOL1 (Asp116-Leu267).
Product name ARO-A11975-50
Uniprot ID O14753
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-A11975
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human OVOL1 (Asp116-Leu267).

Documents

QC & Validation

Anti-Human OVOL1 Polyclonal Antibody binds to Recombinant Human OVOL1 Protein, N-His in WB Assay

Anti-Human OVOL1 Polyclonal Antibody binds to Recombinant Human OVOL1 Protein, N-His in WB Assay

Recombinant Human OVOL1 Protein, N-His(cat. No.ARO-P11809) can bind Anti-Human OVOL1 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human OVOL1 Polyclonal Antibody” Cancel reply

Related products

  • Recombinant Human OVOL1 Protein, N-His

    ARO-P11809

    Recombinant Human OVOL1 Protein, N-His