aroD Recombinant Protein
Katalog-Nummer OPCA02036-1MG
Size : 1mg
Marke : Aviva Systems Biology
AROD Recombinant Protein (Salmonella typhi) (OPCA02036)
| Datasheets/Manuals | Printable datasheet for AROD Recombinant Protein (Salmonella typhi) (OPCA02036) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhi |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Salmonella typhi |
| Additional Information | Relevance: Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
| Protein Sequence | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-252 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Insights into substrate binding and catalysis in bacterial type I dehydroquinase.Maneiro M., Peon A., Lence E., Otero J.M., Van Raaij M.J., Thompson P., Hawkins A.R., Gonzalez-Bello C.Biochem. J. 462:415-424(2014) |
|---|---|
| Gene Symbol | aroD |
| Gene Full Name | 3-dehydroquinase |
| Alias Symbols | STY1760, Type I dehydroquinase, Type I DHQase. |
| NCBI Gene Id | 1248131 |
| Protein Name | 3-dehydroquinate dehydratase |
| Description of Target | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
| Uniprot ID | P24670 |
| Protein Accession # | NP_456161.1 |
| Nucleotide Accession # | NC_003198.1 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 43.6 kda |


