Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> CDK6 (NM_001259) Human Recombinant Protein

CDK6 (NM_001259) Human Recombinant Protein

Drucken Drucken
Melden Sie sich an

Katalog-Nummer TP308560

Size : 20ug


CDK6 (NM_001259) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308560
Recombinant protein of human cyclin-dependent kinase 6 (CDK6), 20 µg
 

Other products for "CDK6 or NM_001259"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208560 protein sequence
Red=Cloning site Green=Tags(s)

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET
FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR
VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA
EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC
LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001250
Locus ID 1021
UniProt ID Q00534
Cytogenetics 7q21.2
RefSeq Size 11628
RefSeq ORF 978
Synonyms MCPH12; PLSTIRE
Summary The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. provided by RefSeq, Aug 2017
Protein Categories Enzyme: Kinases, Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH308560 CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001250) 10 ug
PH327978 CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778) 10 ug
LC400506 Lyophilized CDK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC428809 Lyophilized CDK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400506 Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 1 (as WB positive control) 100 ug
LY428809 Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 2 (as WB positive control) 100 ug
TP327978 Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6), 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
TA323939
CDK6 Rabbit Polyclonal Antibody
 100ul 
TA313266
AKT1 Rabbit Polyclonal Antibody
 100ul