Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)

Katalog-Nummer TMPH-00017-50ug

Size : 50ug

Marke : TargetMol


Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00017 Copy Product Info

Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.

Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
For In stock only · Estimated delivery:EUR Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.
Species
Acholeplasma laidlawii
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberA9NHV3
Synonyms
Holo-ACP synthase,Holo-[acyl-carrier-protein] synthase,acpS,4'-phosphopantetheinyl transferase AcpS
Amino Acid
MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV
Construction
1-118 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight20.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Dose Conversion

You can also refer to dose conversion for different animals. More