Human CD45 recombinant protein

Katalog-Nummer NB-21-27578

Size : 100µg

Marke : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P08575
Molecular weight:
32.79 kDa
Pro223–Thr479 His
Human CD45 recombinant protein

Specifications Human CD45 recombinant protein

Product name PX-P6336-100
Uniprot ID P08575
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFT
Molecular weight 32.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro223-Thr479
Aliases /Synonyms 3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45, PTPRC, CD45Receptor-type tyrosine-protein phosphatase C,
Reference PX-P6336
Molecular Constructor
Pro223–Thr479 His
Product name PX-P6336-1MG
Uniprot ID P08575
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFT
Molecular weight 32.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro223-Thr479
Aliases /Synonyms 3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45, PTPRC, CD45Receptor-type tyrosine-protein phosphatase C,
Reference PX-P6336
Molecular Constructor
Pro223–Thr479 His
Product name PX-P6336-50
Uniprot ID P08575
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFT
Molecular weight 32.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro223-Thr479
Aliases /Synonyms 3.1.3.48, Leukocyte common antigen, L-CA, T200, CD45, PTPRC, CD45Receptor-type tyrosine-protein phosphatase C,
Reference PX-P6336
Molecular Constructor
Pro223–Thr479 His

3D Representation

Human CD45 recombinant protein

Reviews

There are no reviews yet.

Be the first to review “Human CD45 recombinant protein” Cancel reply

Related products

  • Apamistamab Biosimilar - Anti-PTPRC, CD45 mAb binds to Receptor-type tyrosine-protein phosphatase C (PTPRC) CD45 in indirect ELISA Assay

    PX-TA1431

    Apamistamab Biosimilar – Anti-PTPRC, CD45 mAb – Research Grade