Orb605085-1mg | Human SYNGAP1 protein Clinisciences

Human SYNGAP1 protein

SKU: orb605085

This Human SYNGAP1 protein spans the amino acid sequence from region 1161-1343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Signal Transduction

−

Application Notes	Partial

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Tag	N-terminal 6xHis-tagged
Expression Region	1161-1343aa
Protein Length	Partial
MW	25.5 kDa
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

−

Neuronal RasGAP (Synaptic Ras GTPase-activating protein 1) (Synaptic Ras-GAP 1) (KIAA1938)

−