KLF4, N-His, recombinant protein

Katalog-Nummer NB-21-25942

Size : 100ug

Marke : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O43474
Molecular weight:
21.01 kDa
His Leu352–Phe513

Specifications KLF4, N-His, recombinant protein

Product name KLF4, N-His, recombinant protein
Uniprot ID O43474
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Molecular weight 21.01 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu352-Phe513
Protein Accession O43474
Reference PX-P5806
Note For research use only
Molecular Constructor
His Leu352–Phe513

Documents

3D Representation

KLF4, N-His, recombinant protein

Reviews

There are no reviews yet.

Be the first to review “KLF4, N-His, recombinant protein” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody