Nucleoprotein Recombinant Protein (Zaire Ebola virus)
Katalog-Nummer OPCA05225-20UG
Size : 20ug
Size : 20ug
| Datasheets/Manuals | Printable datasheet for NP Recombinant Protein (ZEBOV) (OPCA05225) |
|---|
| Predicted Species Reactivity | Zaire Ebola Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ |
| Source | Yeast |
| Gene Symbol | NP |
|---|---|
| Gene Full Name | nucleoprotein |
| Alias Symbols | Nucleocapsid protein, nucleoprotein, ZEBOVgp1. |
| NCBI Gene Id | 911830 |
| Protein Name | Nucleoprotein |
| Description of Target | Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases. |
| Uniprot ID | P18272 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 31.1 kDa |