Recombinant Human HLA-G Protein, N-GST

Katalog-Nummer NB-21-28812

Size : 100µg

Marke : Neo Biotech


Recombinant Human HLA-G Protein, N-GST

Product name ARO-P14768-100
Uniprot ID P17693
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSH
Molecular weight 37.24 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Met29-His117
Aliases /Synonyms HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G
Reference ARO-P14768
Note For research use only.
Molecular Constructor
GST Met29–His117