Orb3155872-1mg | Recombinant Saccharomyces cerevisiae Lipid-anchored

Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

SKU: orb3155872

Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Metabolism Research; Cell Biology

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

−

Source	E.coli
Biological Origin	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Tag	C-terminal 6xHis-tagged
Expression Region	2-128aa
Protein Length	Full Length of Mature Protein
MW	21.4 kDa
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	SANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.226.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

−

C-terminally palmitoylated protein CPP1;Cysteine-rich protein CPP1

−

UniProt

−

No UniProt data available

Protein Handling and Storage Guide

Protein Handling Guide

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	82.6 kDa
Source:	Mammalian cell