Orb2933924-100ug | Recombinant Subterranean clover stunt virus Putative

Recombinant Subterranean clover stunt virus Putative movement protein(DNA-M)

SKU: orb2933924

This Recombinant Subterranean clover stunt virus Putative movement protein(DNA-M) spans the amino acid sequence from region 1-112.

Infectious Disease & Virology

−

−

Biological Origin	Subterranean clover stunt virus (strain F) (SCSV)
Expression Region	1-112
Protein Length	full length protein
Protein Sequence	MDSGDGYNTYSYEEGAGDAKKEVLYKIGIIMLCIVGIVVLWVLIILCCAVPRYAKSTMDA WLSSSSIMKRKMASRITGTPFEETGPHRERRWAERRTEATNQNNNDNVNRFS

−

Storage	Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

−

Putative movement protein, MP

UniProt

−

No UniProt data available

Protein Handling and Storage Guide

Protein Handling Guide