ST3GAL1 antibody - C-terminal region

Katalog-Nummer ARP45410_P050

Size : 100ul

Marke : Aviva Systems Biology


ST3GAL1 Antibody - C-terminal region (ARP45410_P050)

Datasheets/ManualsPrintable datasheet for anti-ST3GAL1 (ARP45410_P050) antibody
Product Info
Publications

The disulfide catalyst QSOX1 maintains the colon mucosal barrier by regulating Golgi glycosyltransferases

Authors: Ilani, T., Reznik, N., et al.

Journal: EMBO J. 42, e111869 (2023)

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ST3GAL1 (ARP45410_P050) antibody is Catalog # AAP45410 (Previous Catalog # AAPP26377)
ReferenceUhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Gene SymbolST3GAL1
Gene Full NameST3 beta-galactoside alpha-2,3-sialyltransferase 1
Alias SymbolsST3O, SIAT4A, SIATFL, ST3GalA, ST3GalIA, Gal-NAc6S, ST3GalA.1, ST3GalIA,1
NCBI Gene Id6482
Protein NameCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
Description of TargetST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet.
Uniprot IDQ11201
Protein Accession #NP_003024
Nucleotide Accession #NM_003033
Protein Size (# AA)340
Molecular Weight39 kDa
Protein InteractionsGSTA1;

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
ARP49696_P050
 100ul 
ARP46705_T100
 100ul 
ARP48845_P050
 100ul