SYNGAP1 Protein, Human, Recombinant (His)
Katalog-Nummer NB-64-50670-200ug
Size : 200ug
Marke : Neo Biotech
Remove All
SYNGAP1 Protein, Human, Recombinant (His)
(Synonyms: SYNGAP1, Synaptic Ras GTPase-activating protein 1 (Synaptic Ras-GAP 1), Ras/Rap GTPase-activating protein SynGAP, Neuronal RasGAP, KIAA1938) Copy Product InfoSynonyms: SYNGAP1, Synaptic Ras GTPase-activating protein 1 (Synaptic Ras-GAP 1), Ras/Rap GTPase-activating protein SynGAP, Neuronal RasGAP, KIAA1938
Catalog No. TMPH-01997 Copy Product Info
SYNGAP1 Protein, Human, Recombinant (His) is expressed in E. coli.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | SYNGAP1 Protein, Human, Recombinant (His) is expressed in E. coli. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q96PV0 |
| Amino Acid | MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH |
| Construction | 1161-1343 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | SYNGAP1, Synaptic Ras GTPase-activating protein 1 (Synaptic Ras-GAP 1), Ras/Rap GTPase-activating protein SynGAP, Neuronal RasGAP, KIAA1938 |
| Research Background | Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits. |
| Molecular Weight | 25.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
SYNGAP 1Synaptic Ras-GAP1Synaptic Ras-GAP 1KIAA 1938
Related Tags: SYNGAP1 Protein, Human, Recombinant (His) chemical structure | SYNGAP1 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

