YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (HRP)
Katalog-Nummer 253498-HRP-100ul
Size : 100ul
Marke : US Biological
253498-HRP YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (HRP)
Clone Type
MonoclonalHost
mouseIsotype
IgG2a,kGrade
PurifiedApplications
E IF WBAccession #
NP_006097Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq
Applications:
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

