ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)
Katalog-Nummer 372121-20ug
Size : 20ug
Marke : US Biological
372121 ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)
Swiss Prot
P31787Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CBinds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Source:
Recombinant protein corresponding to aa1-87 from saccharomyces cerevisiae ACB1, fused to His-Tag at N-terminal, expressed in Yeast.
Molecular Weight:
~12.1kD
Amino Acid Sequence:
MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

