Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Drucken Drucken
Melden Sie sich an

Katalog-Nummer NB-21-44987

Size : 100µg

Marke : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Target species:
Human
Clone Name:
SAA0437

Specifications Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Product name ARO-A10252-100
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human
Product name ARO-A10252-1MG
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human
Product name ARO-A10252-50
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human

Documents

Reviews

There are no reviews yet.

Be the first to review “Anti-Human FGF2/bFGF Antibody (SAA0437), APC” Cancel reply

Related products

  • Anti-FGF2 Polyclonal antibody binds to Human FGF2/bFGF Recombinant Protein, N-His-SUMO in WB Assay

    ARO-A14173

    Anti-FGF2 Polyclonal antibody