CD81 Recombinant Protein

Katalog-Nummer NB-21-24434

Size : 100ug

Marke : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P60033
Molecular weight:
10.59kDa
His Phe113~Lys201

Specifications CD81 Recombinant Protein

Product name PX-P4091-100
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201
Product name PX-P4091-1MG
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201
Product name PX-P4091-50
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201

Description

General Information about CD81 Recombinant Protein

CD81, also known as TAPA-1, belongs to the transmembrane superfamily 4, also known as the tetraspanin family. Members of this family mediate transduction events that play a role in the regulation of cell development, activation, growth and movement. CD81 is a widely expressed cell surface protein that participates in various amazing biological reactions. It involves the adhesion, morphology, activation, proliferation and differentiation of B cells, T cells and other cells. On B cells, CD81 is part of a complex with CD21, CD19 and Leul3. The combination of ag-specific recognition and CD21-mediated complementary recognition of the complex lowers the threshold for activation of the B cell B cell receptor.

Documents

3D Representation

CD81 Recombinant Protein

Reviews

There are no reviews yet.

Be the first to review “CD81 Recombinant Protein” Cancel reply

Related products

  • SDS-PAGE for Anti-Human CD81 Antibody (005-C01)

    ARO-A15378

    Anti-Human CD81 Antibody (005-C01)