Fibroblast growth factor 1(FGF1) (16-155)
Katalog-Nummer NB-21-24580
Size : 100ug
Size : 100ug
| Product name | Fibroblast Growth Factor proteins 1(FGF1) (16-155) |
|---|---|
| Uniprot ID | P05230 |
| Uniprot link | https://www.uniprot.org/uniprot/P05230 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Molecular weight | 17kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Phe16~Asp155 |
| Protein Accession | P05230 |
| Spec:Entrez GeneID | 2246 |
| Spec:NCBI Gene Aliases | AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha |
| Spec:SwissProtID | Q16588 |
| NCBI Reference | P05230 |
| Aliases /Synonyms | FGFA,aFGF,ECGF,HBGF-1 |
| Reference | PX-P4884 |
| Note | For research use only |
| Molecular Constructor | Phe16~Asp155 His |