Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard

Katalog-Nummer PH302043

Size : 10ug


Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard

Be the first to review this product
SKU
PH302043
GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324)
 
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202043
Predicted MW 52 kDa
Protein Sequence
Protein Sequence
>RC202043 protein sequence
Red=Cloning site Green=Tags(s)

MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSAD
YIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFV
FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSA
KVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTL
CRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIAC
PETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDL
AVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073324
RefSeq Size 3318
RefSeq ORF 1410
Synonyms GN-2; GN2
Locus ID 8908
UniProt ID O15488
Cytogenetics Xp22.33
Summary This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.provided by RefSeq, May 2010
SKU Description Size
LC421559 Lyophilized GYG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC433068 Lyophilized GYG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY421559 Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 1 (as WB positive control) 100 ug
LY433068 Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 4 (as WB positive control) 100 ug
TP302043 Recombinant protein of human glycogenin 2 (GYG2), transcript variant 1, 20 µg 20 ug
TP330068 Recombinant protein of human glycogenin 2 (GYG2), transcript variant 4, 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products