Human IGFBP1 Nter Recombinant Protein

Specifications Human IGFBP1 Nter Recombinant Protein

Product name	Human IGFBP1 Nter Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight	17.59 kD
Purity estimated	85%
Buffer	PBS, pH 7.5 with 0.2mM β-Met
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2078
Note	For research use only
Molecular Constructor	Partial

Product name	Human IGFBP1 Nter Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight	17.59 kD
Purity estimated	85%
Buffer	PBS, pH 7.5 with 0.2mM β-Met
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2078
Note	For research use only
Molecular Constructor	Partial

Product name	PX-P2078-1MG
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight	17.59 kD
Purity estimated	85%
Buffer	PBS, pH 7.5 with 0.2mM β-Met
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2078
Note	For research use only
Molecular Constructor	Partial

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Human IGFBP1 Nter Recombinant Protein” Cancel reply