LEPROTL1 Rabbit Polyclonal Antibody (FITC)
Katalog-Nummer orb2089059-100ul
Size : 100ul
Marke : Biorbyt
Description
Images & Validation
−Related Conjugates & Formulations
−Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1 |
| Protein Sequence | Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI |
| Molecular Weight | 14kDa |
| Purification | Affinity Purified |
| Conjugation | FITC |
Storage & Handling
−| Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Vps55, my047, HSPC112
−
LEPROTL1 Rabbit Polyclonal Antibody (FITC) [orb189216]
ICC, IF
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
FITC
100 μl
Protocol Information
WB
Western Blot (IB, immunoblot)


