Host species: Bacillus subtilis Origin species: Thermus phage TSP4 Uniprot ID: A0A411CWC0 Met1–Lys166 His Datasheet MSDS Specifications Peptidoglycan hydrolase Product name Peptidoglycan hydrolase Uniprot ID A0A411CWC0 Origin species Thermus phage TSP4 Expression system Prokaryotic expression Raw Antigen Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH Protein delivered with Tag? C-terminal His Tag Purity estimated >90%by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Bacillus subtilis Fragment Type Met1-Lys166 Reference PX-P4658 Note For research use only Molecular Constructor Met1–Lys166 His Product name Peptidoglycan hydrolase Uniprot ID A0A411CWC0 Origin species Thermus phage TSP4 Expression system Prokaryotic expression Raw Antigen Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH Protein delivered with Tag? C-terminal His Tag Purity estimated >90%by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Delivery lead time in business days Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Bacillus subtilis Fragment Type Met1-Lys166 Reference PX-P4658 Note For research use only Molecular Constructor Met1–Lys166 His Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “Peptidoglycan hydrolase” Cancel reply
There are no reviews yet.