Recombinant Human KCNA3 Protein, N-His

Katalog-Nummer NB-21-32018

Size : 100µg

Marke : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P22001
Molecular weight:
17.77 kDa
Arg105–Ser230

Specifications Recombinant Human KCNA3 Protein, N-His

Product name ARO-P11766-100
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230
Product name ARO-P11766-1MG
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230
Product name ARO-P11766-50
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230

Description

Introduction to Recombinant Human KCNA3 Protein:

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the DNA sequence of a desired protein is inserted into an expression system, such as bacteria or yeast, to produce large quantities of the protein. Recombinant proteins have become essential tools in various fields of science, including biotechnology, medicine, and research.

One such recombinant protein is the Recombinant Human KCNA3 Protein, also known as the voltage-gated potassium channel subunit Kv1.3. This protein belongs to the Kv1 family of voltage-gated potassium channels and plays a crucial role in regulating the electrical activity of cells.

Structure of Recombinant Human KCNA3 Protein:

The Recombinant Human KCNA3 Protein is a transmembrane protein that consists of six membrane-spanning segments, with the N- and C-termini located on the intracellular side. The protein is composed of 501 amino acids and has a molecular weight of 57 kDa. It is encoded by the KCNA3 gene, located on chromosome 1 in humans.

Activity of Recombinant Human KCNA3 Protein:

The primary function of the Recombinant Human KCNA3 Protein is to act as a voltage-gated potassium channel, which means it allows the flow of potassium ions across the cell membrane in response to changes in membrane potential. This activity is essential for maintaining the resting membrane potential and regulating the excitability of cells, particularly in the nervous system.

The Recombinant Human KCNA3 Protein is predominantly expressed in T-lymphocytes and plays a crucial role in their activation and proliferation. It is also found in other cell types, such as neurons, where it regulates the firing of action potentials. Additionally, this protein is involved in various physiological processes, including muscle contraction, hormone secretion, and cell growth.

Application of Recombinant Human KCNA3 Protein:

The Recombinant Human KCNA3 Protein has several applications in different fields of science. One of the major applications is in drug discovery and development. The Kv1.3 channel has been identified as a potential target for various diseases, including autoimmune disorders, cancer, and neurological disorders. Recombinant Human KCNA3 Protein can be used to screen and develop new drugs that can modulate the activity of this channel, thereby treating these diseases.

Another application of this protein is in immunology research. The Kv1.3 channel is highly expressed in T-lymphocytes, making it an attractive target for studying the immune response. Recombinant Human KCNA3 Protein can be used to study the role of this channel in T-cell activation, proliferation, and differentiation, which can provide valuable insights into the immune system and its dysregulation in various diseases.

Furthermore, the Recombinant Human KCNA3 Protein has potential applications in neuroscience research. It is involved in regulating the electrical activity of neurons, making it a crucial player in neuronal excitability and synaptic transmission. Recombinant Human KCNA3 Protein can be used to study the role of this channel in various neurological disorders, such as epilepsy and multiple sclerosis.

Conclusion:

In conclusion, the Recombinant Human KCNA3 Protein is a vital component of the Kv1 family of voltage-gated potassium channels. It plays a crucial role in regulating the electrical activity of cells and is involved in various physiological processes. This protein has numerous applications in drug discovery, immunology, and neuroscience research, making it a valuable tool in the scientific community. Further studies on this protein may lead to the development of new treatments for various diseases and provide a better understanding of its role in cellular function.

Documents

3D Representation

Recombinant Human KCNA3 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human KCNA3 Protein, N-His” Cancel reply

Related products

  • SDS-PAGE for Anti-Human KCNA3 VHH (SAA0971)

    ARO-A16425

    Anti-Human KCNA3 VHH (SAA0971)