Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial
Katalog-Nummer orb2986312-1mg
Size : 1mg
Marke : Biorbyt
Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial
SKU: orb2986312
Description
Research Area
Infectious Disease & Virology
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Reston ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola virus) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 34-325aa |
| Protein Length | Partial |
| MW | 35.7 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MPLGIVTNSTLKATEIDQLVCRDKLSSTSQLKSVGLNLEGNGIATDVPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKSDGSECLPLPPDGVRGFPRCRYVHKVQGTGPCPGDLAFHKNGAFFLYDRLASTVIYRGTTFAEGVIAFLILSEPKKHFWKATPAHEPVNTTDDSTSYYMTLTLSYEMSNFGGEESNTLFKVDNHTYVQLDRPHTPQFLVQLNETLRRNNRLSNSTGRLTWTVDPKIEPDVGEWAFWETKKTFPNNFMEKTCISKFYQPTPTTPQIRARR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−pre-sGP;sGP
−
Recombinant Reston ebolavirus Pre-small/secreted glycoprotein (GP), partial [orb2986313]
Greater than 85% as determined by SDS-PAGE.
33.9 kDa
E.coli
1 mg, 100 μg, 20 μg
Quick Database Links
UniProt
UniProt Details
− Loading UniProt data...
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


