TNF Recombinant Protein
Katalog-Nummer OPCA01905-20UG
Size : 20ug
Marke : Aviva Systems Biology
TNF Recombinant Protein (Sheep) (OPCA01905)
| Datasheets/Manuals | Printable datasheet for TNF Recombinant Protein (Sheep) (OPCA01905) |
|---|
| Predicted Species Reactivity | Ovis aries|Sheep |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Sheep |
| Additional Information | Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL |
| Protein Sequence | LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 78-234 aa |
| Tag | N-terminal GST-tagged |
| Reference | Molecular cloning, expression and characterization of ovine TNF alpha.Andrews A.E., Nash A.D., Barcham G.J., Brandon M.R.Immunol. Cell Biol. 69:273-283(1991) |
|---|---|
| Gene Symbol | TNF |
| Gene Full Name | tumor necrosis factor |
| Alias Symbols | cachectin, TNF-a, TNF-alpha, tumor necrosis factor, tumor necrosis factor (TNF superfamily, member 2), tumor necrosis factor alpha, tumor necrosis factor ligand superfamily member 2. |
| NCBI Gene Id | 443540 |
| Protein Name | Tumor necrosis factor |
| Description of Target | Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. |
| Uniprot ID | P23383 |
| Protein Accession # | NP_001020031.1 |
| Nucleotide Accession # | NM_001024860.1 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 44.2 kDa |







